PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 85536
Common NameSELMODRAFT_85536
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ZF-HD
Protein Properties Length: 171aa    MW: 18928.6 Da    PI: 9.2152
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
85536genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.69.3e-311466659
  ZF-HD_dimer  6 YkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 Y +ClkNhAa +Ggha+DGCgEfmp  geegt +alkCaAC+CHRnFHRreve 
        85536 14 YTQCLKNHAAGIGGHALDGCGEFMPC-GEEGTLDALKCAACDCHRNFHRREVEG 66
                 9************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152327.0321463IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.5E-271464IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.1E-291464IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-211470IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.5E-3298169IPR009057Homeodomain-like
SuperFamilySSF466891.54E-1998168IPR009057Homeodomain-like
TIGRFAMsTIGR015658.5E-27107163IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
RLRGGGGGGG GRGYTQCLKN HAAGIGGHAL DGCGEFMPCG EEGTLDALKC AACDCHRNFH  60
RREVEGEPSC LECHHRKDKK RLMLPSRSGE LDDQGVYMPN AGGPNLKKRF RTKFTGDQKE  120
RMLAFADKVG WKIQKHDEAE VQQFCNEVGV KRHVLKVWMH NNKHTLGKKM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-261081651875ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1211RGGGGGGGGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002966118.11e-124hypothetical protein SELMODRAFT_85536, partial
SwissprotQ6YXH55e-62ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLD8R5F81e-123D8R5F8_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ321451e-123(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-59homeobox protein 22
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]